PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016450701.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 269aa    MW: 29912 Da    PI: 10.1411
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016450701.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.7e-14102146347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
   XP_016450701.1 102 PWTEEEHRKFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 146
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.73520IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.26595151IPR017930Myb domain
SuperFamilySSF466898.97E-1896152IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-1798149IPR006447Myb domain, plants
SMARTSM007175.3E-1099149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-1199145IPR009057Homeodomain-like
PfamPF002493.4E-11102146IPR001005SANT/Myb domain
CDDcd001672.39E-9102147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MKMGRKCSHC GNTGHNSRTC STLKCANTGS FIGGLKLFGV QLDIPNNASS SSSSSIHLKK  60
SFSLDCLSPS VNESCEKSTS INNGYLSDGL VVRVEKRKKG APWTEEEHRK FLIGLEKLGK  120
GDWRGISRNF VTTRTPTQVA SHAQKYFLRH SSLNKKKRRS SLFDMARSNN NKMHVDAITM  180
KFKRADNFGN CLDTKIVPKK DYQEIRASLL DLNSFGEDMP IGKDNQRSEY PQQPEEIYSV  240
PNKSISSFGA LDLELSLSAP RNIGPITVT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1154158KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754512e-59HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760073.10.0PREDICTED: transcription factor MYB1R1-like
RefseqXP_016450701.10.0PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A0V0HK381e-100A0A0V0HK38_SOLCH; Putative transcription factor MYB1R1-like
STRINGPGSC0003DMT4000009027e-94(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33852147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.15e-51MYB_related family protein